PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G074700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family DBB
Protein Properties Length: 327aa    MW: 33970.8 Da    PI: 5.1803
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G074700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.78.6e-07446541
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         C+ +e  e++  C  ++  lC+ C  e H        H++ p
  Sevir.3G074700.1.p  4 LCSACEAAEASVLCCADDAALCARCDREVHAAnrlagkHQRLP 46
                        7******99*********************6577888998877 PP

2zf-B_box31.24.6e-106498337
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkgH 37
                        ++kC+ ++e  + +fC +++ llC++C ++ H   
  Sevir.3G074700.1.p 64 PPKCDICQESDAYFFCLEDRALLCRSCDVAVHTAN 98
                        689******99*********************653 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.879147IPR000315B-box-type zinc finger
SMARTSM003364.0E-10147IPR000315B-box-type zinc finger
CDDcd000211.18E-7347No hitNo description
SuperFamilySSF578455.19E-561104No hitNo description
SMARTSM003363.9E-1662109IPR000315B-box-type zinc finger
PfamPF006432.4E-86496IPR000315B-box-type zinc finger
CDDcd000211.64E-965109No hitNo description
PROSITE profilePS501199.48567109IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MKVLCSACEA AEASVLCCAD DAALCARCDR EVHAANRLAG KHQRLPLLAP GGQNAAAAAA  60
AVSPPKCDIC QESDAYFFCL EDRALLCRSC DVAVHTANTF VSAHRRFLLT GVQVGQELDD  120
PAPEPPETSP PPPTKSDPAP PLFGESDFSW AAGVTGTLAD WSVVNEQFGG SPAPRHAEAA  180
SRATPKRSPR APAFGAGQAR IAGGVMDWPL GEFFRGVSDF NGGFSFGESG TSKADSGKLG  240
GSAGGSPYYR SSSEDRDANE LFGQVPEIQW SVPELPSPLT ASGLHWQHGG GPDSTAFVPD  300
ICSPDSAVRC FPTAAAAAAA KRQRNR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1320325KRQRNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960600.10.0PREDICTED: B-box zinc finger protein 22-like
TrEMBLK3Z7Y00.0K3Z7Y0_SETIT; Uncharacterized protein
STRINGSi022650m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17943382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.15e-48light-regulated zinc finger protein 1